General Information

  • ID:  hor006414
  • Uniprot ID:  P23582
  • Protein name:  CNP-53
  • Gene name:  NPPC
  • Organism:  Homo sapiens (Human)
  • Family:  Natriuretic peptide family
  • Source:  Human
  • Expression:  [CNP-22]: In the kidney, predominantly expressed in the distal tubular cells (at protein level).
  • Disease:  Diseases associated with NPPC include Achondroplasia and Acromesomelic Dysplasia 1.
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0051427 hormone receptor binding
  • GO BP:  GO:0001503 ossification; GO:0001525 angiogenesis; GO:0001541 ovarian follicle development; GO:0001549 cumulus cell differentiation; GO:0001666 response to hypoxia; GO:0001974 blood vessel remodeling; GO:0002931 response to ischemia; GO:0003418 growth plate cartilage chondrocyte differentiation; GO:0003419 growth plate cartilage chondrocyte proliferation; GO:0006182 cGMP biosynthetic process; GO:0006457 protein folding; GO:0006874 intracellular calcium ion homeostasis; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0008285 negative regulation of cell population proliferation; GO:0009410 response to xenobiotic stimulus; GO:0009611 response to wounding; GO:0009791 post-embryonic development; GO:0010753 positive regulation of cGMP-mediated signaling; GO:0019934 cGMP-mediated signaling; GO:0022414 reproductive process; GO:0032966 negative regulation of collagen biosynthetic process; GO:0035483 gastric emptying; GO:0036293 response to decreased oxygen levels; GO:0040014 regulation of multicellular organism growth; GO:0043524 negative regulation of neuron apoptotic process; GO:0045471 response to ethanol; GO:0045669 positive regulation of osteoblast differentiation; GO:0048513 animal organ development; GO:0048599 oocyte development; GO:0048660 regulation of smooth muscle cell proliferation; GO:0048678 response to axon injury; GO:0051276 chromosome organization; GO:0051321 meiotic cell cycle; GO:0051447 negative regulation of meiotic cell cycle; GO:0061939 c-di-GMP signaling; GO:0071965 multicellular organismal locomotion; GO:0090649 response to oxygen-glucose deprivation; GO:0097746 blood vessel diameter maintenance; GO:1900194 negative regulation of oocyte maturation; GO:1903537 meiotic cell cycle process involved in oocyte maturation; GO:1904588 cellular response to glycoprotein; GO:2000279 negative regulation of DNA biosynthetic proce
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0032991 protein-containing complex

Sequence Information

  • Sequence:  DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
  • Length:  53
  • Propeptide:  MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
  • Signal peptide:  MHLSQLLACALLLTLLSLRPSEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [CNP-22]: Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation (By similarity). May also be vasoactive and natriuretic (PubMed:1672777). Acts by specifically binding and stimulating NPR2 to produce cGMP (PubMed:1672777, PubMed:21098034). Binds the clearance receptor NPR3 (PubMed:11533490).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR2, NPR3
  • Target Unid:  P20594, P17342
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  37-53
  • Structure ID:  AF-P23582-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006414_AF2.pdbhor006414_ESM.pdb

Physical Information

Mass: 673149 Formula: C251H419N81O71S3
Absent amino acids: Common amino acids: GKL
pI: 10.93 Basic residues: 13
Polar residues: 17 Hydrophobic residues: 16
Hydrophobicity: -64.15 Boman Index: -11696
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 73.77
Instability Index: 1811.51 Extinction Coefficient cystines: 7115
Absorbance 280nm: 136.83

Literature

  • PubMed ID:  2018508
  • Title:  Gene and precursor structures of human C-type natriuretic peptide.
  • PubMed ID:  1339402
  • Title:  Human C-type natriuretic peptide. Characterization of the gene and peptide.
  • PubMed ID:  15815621
  • Title:  Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  1472040
  • Title:  Isolation and identification of C-type natriuretic peptide in human monocytic cell line, THP-1.
  • PubMed ID:  1672777
  • Title:  Selective activation of the B natriuretic peptide receptor by C-type natriuretic peptide (CNP).
  • PubMed ID:  9794555
  • Title:  The renal natriuretic peptide urodilatin is present in human kidney.
  • PubMed ID:  21098034
  • Title:  Insulin-degrading enzyme modulates the natriuretic peptide-mediated signaling response.
  • PubMed ID:  11533490
  • Title:  Allosteric activation of a spring-loaded natriuretic peptide receptor dimer by hormone.